missing translation for 'onlineSavingsMsg'
Learn More

Claudin-14 Antibody (3D11), Novus Biologicals™

Product Code. 18352649 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18352649 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18352649 Supplier Novus Biologicals Supplier No. H00023562M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Claudin-14 Monoclonal antibody specifically detects Claudin-14 in Human samples. It is validated for ELISA, Immunoprecipitation, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Claudin-14
Applications ELISA, Immunoprecipitation, Sandwich ELISA
Classification Monoclonal
Clone 3D11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_036262
Gene Alias claudin 14, DFNB29, human CLDN14 gene10claudin-14
Host Species Mouse
Immunogen CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23562
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.