missing translation for 'onlineSavingsMsg'
Learn More

Clathrin Heavy Chain 1/CHC17 Rabbit anti-Human, Mouse, Rat, Clone: 9M2G2, Novus Biologicals™

Product Code. 18388634
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18388634 100 μg 100µL
18328511 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18388634 Supplier Novus Biologicals Supplier No. NBP316518100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Clathrin Heavy Chain 1/CHC17 Monoclonal antibody specifically detects Clathrin Heavy Chain 1/CHC17 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Clathrin Heavy Chain 1/CHC17
Applications Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 9M2G2
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CHC, CHC17, clathrin heavy chain 1, Clathrin heavy chain on chromosome 17, clathrin, heavy chain, clathrin, heavy chain (Hc), clathrin, heavy polypeptide (Hc), clathrin, heavy polypeptide-like 2, CLH17, CLH-17, CLTCL2, Hc, KIAA0034
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin Heavy Chain 1/CHC17 (Q00610). SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Trafficking and Chaperones, Membrane Vesicle Markers
Primary or Secondary Primary
Gene ID (Entrez) 1213
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.