missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CL-K1/COLEC11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£342.00 - £470.00
Specifications
| Antigen | CL-K1/COLEC11 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18457230
|
Novus Biologicals
NBP1-81120-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18249585
|
Novus Biologicals
NBP1-81120 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CL-K1/COLEC11 Polyclonal specifically detects CL-K1/COLEC11 in Human, Parasite samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CL-K1/COLEC11 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CLK1, CL-K1, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, collectin kidney I, Collectin kidney protein 1, collectin sub-family member 11, collectin-11, DKFZp686N1868, MGC3279 | |
| COLEC11 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9BWP8 | |
| 78989 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:INDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title