missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CKS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | CKS2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232428
|
Novus Biologicals
NBP3-38051-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232072
|
Novus Biologicals
NBP3-38051-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CKS2 Polyclonal antibody specifically detects CKS2 in Rat samples. It is validated for ELISA,Western BlotSpecifications
| CKS2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers | |
| PBS (pH 7.3), 50% glycerol | |
| 1164 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Rat | |
| CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human CKS2 (NP_001818.1).,, Sequence:, MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title