missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CKI gamma 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CKI gamma 3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CKI gamma 3 Polyclonal specifically detects CKI gamma 3 in Human samples. It is validated for Western Blot.Specifications
| CKI gamma 3 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| casein kinase 1, gamma 3, casein kinase I isoform gamma-3, CKI-gamma 3, EC 2.7.11, EC 2.7.11.1 | |
| CSNK1G3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9Y6M4 | |
| 1456 | |
| Synthetic peptides corresponding to CSNK1G3(casein kinase 1, gamma 3) The peptide sequence was selected from the middle region of CSNK1G3. Peptide sequence LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title