CIZ1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Brand:  Novus Biologicals NBP2-33890-25ul

Product Code. 18453432

Description

CIZ1 Polyclonal specifically detects CIZ1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CIZ1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9ULV3
• Gene Symbols: CIZ1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 25792
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CDKN1A interacting zinc finger protein 1, CDKN1A-interacting zinc finger protein 1, cip1-interacting zinc finger protein, LSFR1ZNF356Nuclear protein NP94, NP94, Zinc finger protein 356
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human CIZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only