missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cip4 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33218-20ul
This item is not returnable.
View return policy
Description
Cip4 Monoclonal antibody specifically detects Cip4 in Human,Mouse samples. It is validated for ELISA,Western Blot
Specifications
| Cip4 | |
| Monoclonal | |
| Western Blot 1:100 - 1:500, ELISA Recommended starting concentration is 1 μg/mL | |
| cdc42-interacting protein 4, CIP4STOT, HSTP, Protein Felic, Salt tolerant protein, salt tolerator, STPTRIP-10, thyroid hormone receptor interactor 10, thyroid receptor interacting protein 10, Thyroid receptor-interacting protein 10, TR-interacting protein 10 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cip4 (Q15642).,, Sequence:, MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCL | |
| 20 μL | |
| Cancer | |
| 9322 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction