CILP, Mouse anti-Human, Clone: 2D10, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00008483-M03.100ug

Product Code. 16148625

Description

Sequence: NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML

Specifications

• Antigen: CILP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: cartilage intermediate layer protein, nucleotide pyrophosphohydrolase
• Gene Alias: CILP-1/HsT18872
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA
• Clone: 2D10
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_003613
• Gene Symbols: CILP
• Immunogen: CILP (NP_003604, 129 a.a. ∼ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 8483
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ