missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIITA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£321.00 - £526.00
Specifications
| Antigen | CIITA |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18310596
|
Novus Biologicals
NBP3-17818-25UL |
25 μg |
£321.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18333554
|
Novus Biologicals
NBP3-17818-100UL |
100 μg |
£526.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CIITA Polyclonal antibody specifically detects CIITA in Human samples. It is validated for ImmunofluorescenceSpecifications
| CIITA | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 4261 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C2TA, C2TAMHC class II transactivator type III, CIITAIV, class II, major histocompatibility complex, transactivator, MHC class II transactivator, MHC2TANLR family, acid domain containing, NLRA, nucleotide-binding oligomerization domain, leucine rich repeat and acid domaincontaining | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSMPEPALT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title