missing translation for 'onlineSavingsMsg'
Learn More

CIDEC Antibody (2E2), Novus Biologicals™

Product Code. 18425269 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18425269 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18425269 Supplier Novus Biologicals Supplier No. H00063924M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

CIDEC Monoclonal antibody specifically detects CIDEC in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen CIDEC
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2E2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_071377
Gene Alias cell death activator CIDE-3, cell death-inducing DFFA-like effector c, Cell death-inducing DFFA-like effector protein C, CIDE-3, CIDEX, Fat-specific protein FSP27 homolog, FLJ20871, Fsp27, FSP27fat specific protein 27
Host Species Mouse
Immunogen CIDEC (NP_071377.2, 53 a.a. ∽ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 63924
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.