missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58792-25ul
This item is not returnable.
View return policy
Description
CIB1 Polyclonal specifically detects CIB1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| CIB1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| calcium and integrin binding 1 (calmyrin), Calcium- and integrin-binding protein, calmyrin, CIBcalcium and integrin binding protein, CIBP, DNA-dependent protein kinase interacting protein, DNA-PKcs-interacting protein, Kinase-interacting protein, KIP1, KIPcalcium and integrin binding, protein kinase interacting protein, PRKDCIP, SIP2-28calcium and integrin-binding protein 1, Snk interacting protein 2-28, SNK-interacting protein 2-28 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| CIB1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF | |
| 25 μL | |
| Signal Transduction | |
| 10519 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction