missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Chymotrypsin-like protease Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Chymotrypsin-like protease |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Chymotrypsin-like protease Polyclonal specifically detects Chymotrypsin-like protease in Human samples. It is validated for Western Blot.Specifications
| Chymotrypsin-like protease | |
| Polyclonal | |
| Rabbit | |
| P40313 | |
| 1506 | |
| Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821 | |
| CTRL | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title