CHTF18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57605

Product Code. 18249992

Description

CHTF18 Polyclonal specifically detects CHTF18 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CHTF18
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 63922
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8WVB6
• Gene Symbols: CHTF18
• Immunogen: Synthetic peptides corresponding to CHTF18 (CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of CHTF18)(50ug). Peptide sequence QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Rat: 92%; Zebrafish: 83%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG