CHST12 Antibody (3D6), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00055501-M01

Product Code. 18358939

Description

CHST12 Monoclonal antibody specifically detects CHST12 in Human samples. It is validated for Western Blot, ELISA, ELISA

Specifications

• Antigen: CHST12
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: C4S-2, C4ST2C4ST-2, carbohydrate (chondroitin 4) sulfotransferase 12, carbohydrate sulfotransferase 12, Chondroitin 4-O-sulfotransferase 2, Chondroitin 4-sulfotransferase 2, EC 2.8.2.5, Sulfotransferase Hlo
• Immunogen: CHST12 (NP_061111.1, 56 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDRELTADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFPTKERAFDDIP
• Quantity: 0.1 mg
• Research Discipline: Cancer, Cell Biology, Cytoskeleton Markers, Endocrinology, Signal Transduction
• Gene ID (Entrez): 55501
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Sandwich ELISA
• Clone: 3D6
• Dilution: Western Blot 1:500
• Gene Accession No.: NP_061111
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified