missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Chondroadherin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Chondroadherin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Chondroadherin Polyclonal specifically detects Chondroadherin in Human samples. It is validated for Western Blot.Specifications
| Chondroadherin | |
| Polyclonal | |
| Rabbit | |
| O15335 | |
| 1101 | |
| Synthetic peptides corresponding to CHAD(chondroadherin) The peptide sequence was selected from the middle region of Chondroadherin. Peptide sequence LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chondroadherin, chondroadherin proteoglycan, SLRR4ACartilage leucine-rich protein | |
| CHAD | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title