Choline Kinase beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-85632-25ul

Product Code. 18480072

Description

Choline Kinase beta Polyclonal specifically detects Choline Kinase beta in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Choline Kinase beta
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CHKB
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CEWVYDYTHEEWPFYKARPTDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWS
• Quantity: 25 μL
• Research Discipline: Checkpoint signaling, DNA Repair
• Gene ID (Entrez): 1120
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.05mg/mL
• Dilution: Immunohistochemistry 1:20-1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CHETKcholine/ethanolamine kinase beta, CHKLcholine kinase-like, choline kinase betaEK, Choline kinase-like protein, CK, CKB, CKEKBEKBcholine/ethanolamine kinase, EC 2.7.1.32, EC 2.7.1.82, Ethanolamine kinase, Ethanolamine kinase beta
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only