CHMP5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48776-25ul

Product Code. 18612056

Description

CHMP5 Polyclonal antibody specifically detects CHMP5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CHMP5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: apoptosis-related protein PNAS-2, C9orf83, charged multivesicular body protein 5, chromatin modifying protein 5, Chromatin-modifying protein 5, chromosome 9 open reading frame 83, HSPC177, hVps60, PNAS-2, SNF7 domain containing 2, SNF7 domain-containing protein 2, SNF7DC2, Vacuolar protein sorting-associated protein 60, Vps60CGI-34
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRV
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51510
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified