missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHMP4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00
Specifications
| Antigen | CHMP4B |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CHMP4B Polyclonal specifically detects CHMP4B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CHMP4B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 128866 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C20orf178, charged multivesicular body protein 4b, CHMP4A, CHMP4b, chromatin modifying protein 4B, Chromatin-modifying protein 4b, chromosome 20 open reading frame 178, dJ553F4.4, hSnf7-2, hVps32-2, SHAX1, SNF7, SNF7 homolog associated with Alix 1, Snf7 homologue associated with Alix 1, SNF7-2CTPP3, Vacuolar protein sorting-associated protein 32-2, vacuolar protein-sorting-associated protein 32-2, Vps32-2, VPS32B | |
| CHMP4B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title