missing translation for 'onlineSavingsMsg'
Learn More

CHMP2A Antibody, Novus Biologicals™

Product Code. 18355119 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18355119 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18355119 Supplier Novus Biologicals Supplier No. H00027243B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

CHMP2A Polyclonal antibody specifically detects CHMP2A in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen CHMP2A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH02502
Gene Alias BC-2, BC2VPS2 homolog A, CHMP2a, CHMP2hVps2-1, chromatin modifying protein 2A, Chromatin-modifying protein 2a, Putative breast adenocarcinoma marker BC-2, Vacuolar protein sorting-associated protein 2-1, vps2-1, VPS2Aputative breast adenocarcinoma marker (32kD), VPS2charged multivesicular body protein 2a
Host Species Mouse
Immunogen CHMP2A (AAH02502, 1 a.a. - 222 a.a.) full-length human protein. MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Autophagy, Cell Biology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 27243
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.