missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18359348

CHMP1a Antibody, Novus Biologicals™

Product Code. 18359348 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18359348 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18359348 Supplier Novus Biologicals Supplier No. H00005119B02P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

CHMP1a Polyclonal antibody specifically detects CHMP1a in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CHMP1a
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Alias CHMP1, CHMP1charged multivesicular body protein 1/chromatin modifying protein 1, chromatin modifying protein 1A, Chromatin-modifying protein 1a, hVps46-1, KIAA0047charged multivesicular body protein 1a, PCOLN3protease, metallo, 1, 33kD, procollagen (type III) N-endopeptidase, PRSM1CHMP1a, Vacuolar protein sorting-associated protein 46-1, VPS46-1, VPS46A
Host Species Mouse
Immunogen CHMP1A (N/A, 1 a.a. - 196 a.a.) full-length human protein. MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Cell Cycle and Replication, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5119
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.