CHML Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-76560-25ul

Product Code. 18660031

Description

CHML Polyclonal specifically detects CHML in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CHML
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Choroideraemia-like protein, choroideremia-like (Rab escort protein 2), FLJ10071, Rab escort protein 2, rab proteins geranylgeranyltransferase component A 2, REP-2, REP-2, Rab escort protein 2, REP2FLJ13361
• Host Species: Rabbit
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: CHML
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY
• Regulatory Status: RUO
• Gene ID (Entrez): 1122
• Target Species: Human
• Form: Purified