CHIP/STUB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18114178	Novus Biologicals NBP2-47509	0.1 mL
18622036	Novus Biologicals NBP2-47509-25ul	25 μL

Description

CHIP/STUB1 Polyclonal specifically detects CHIP/STUB1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CHIP/STUB1
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 10273
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CHIPSTIP1 homology and U box-containing protein 1, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP, EC 6.3.2.-, heat shock protein A binding protein 2 (c-terminal), HSPABP2, NY-CO-7, SDCCAG7, serologically defined colon cancer antigen 7, STIP1 homology and U-box containing protein 1, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, UBOX1
• Gene Symbols: STUB1
• Isotype: IgG
• Purification Method: Affinity Purified

For Research Use Only