missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ChGn Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ChGn |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ChGn Polyclonal specifically detects ChGn in Human samples. It is validated for Western Blot.Specifications
| ChGn | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| beta4GalNAcT, Beta4GalNAcT-1, CHGN, chondroitin beta1,4 N-acetylgalactosaminyltransferase, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, chondroitin sulfate N-acetylgalactosaminyltransferase 1, CSGalNAcT-1, EC 2.4.1.174, FLJ11264, FLJ13760, GALNACT1 | |
| CSGALNACT1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TDX6 | |
| 55790 | |
| Synthetic peptides corresponding to CHGN The peptide sequence was selected from the C terminal of CHGN. Peptide sequence DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title