CHERP Antibody (1A5), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00010523-M02

Product Code. 18356318

Description

CHERP Monoclonal antibody specifically detects CHERP in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: CHERP
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: calcium homeostasis endoplasmic reticulum protein, DAN16, DAN26, ERPROT 213-21, ERPROT213-21, protein with polyglutamine repeat, SCAF6, SRA1, SR-related CTD associated factor 6, SR-related CTD-associated factor 6
• Immunogen: CHERP (AAH21294.1, 795 a.a. ~ 883 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSNSAPPIPDSRLGEENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARDEC
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA
• Clone: 1A5
• Dilution: Western Blot 1:500
• Gene Accession No.: NP_006378
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10523
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2b κ