Chemokine-like factor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59506

Product Code. 18297762

Description

Chemokine-like factor Polyclonal specifically detects Chemokine-like factor in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Chemokine-like factor
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CKLF
• Immunogen: Synthetic peptides corresponding to CKLF(chemokine-like factor) The peptide sequence was selected from the N terminal of CKLF. Peptide sequence MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: C32CKLF2, chemokine-like factor, chemokine-like factor 1, chemokine-like factor 2, chemokine-like factor 3, chemokine-like factor 4, CKLF1, CKLF3, CKLF4, HSPC224, transmembrane proteolipid, UCK-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51192
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.