CHD2 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-92117-0.1ml

Product Code. 18692721

Description

CHD2 Polyclonal antibody specifically detects CHD2 in Human samples. It is validated for Western Blot

Specifications

• Antigen: CHD2
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: ATP-dependent helicase CHD2, CHD-2, chromodomain helicase DNA binding protein 2, chromodomain-helicase-DNA-binding protein 2, DKFZp547I1315, DKFZp686E01200, DKFZp781D1727, EC 3.6.1, EC 3.6.4.12, FLJ38614
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1729-1828 of human CHD2 (NP_001262.3). DEFRPQNYHQQDFRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPDYNWNVRKT
• Quantity: 0.1 mL
• Research Discipline: Chromatin Research
• Gene ID (Entrez): 1106
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified