missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHCHD7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35859-100ul
This item is not returnable.
View return policy
Description
CHCHD7 Polyclonal antibody specifically detects CHCHD7 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| CHCHD7 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| coiled-coil-helix-coiled-coil-helix domain containing 7, coiled-coil-helix-coiled-coil-helix domain-containing protein 7, FLJ40966, MGC2217 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human CHCHD7 (NP_077276.2).,, Sequence:, MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY | |
| 100 μL | |
| Cancer, Cell Cycle and Replication | |
| 79145 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction