missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CHAC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CHAC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHAC2 Polyclonal specifically detects CHAC2 in Human, Rat samples. It is validated for Western Blot.Specifications
| CHAC2 | |
| Polyclonal | |
| Rabbit | |
| Q8WUX2 | |
| 494143 | |
| Synthetic peptides corresponding to CHAC2(ChaC, cation transport regulator homolog 2 (E. coli)) The peptide sequence was selected from the N terminal of CHAC2. Peptide sequence MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| cation transport regulator-like protein 2, ChaC, cation transport regulator homolog 2 (E. coli), ChaC, cation transport regulator-like 2, ChaC, cation transport regulator-like 2 (E. coli) | |
| CHAC2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title