missing translation for 'onlineSavingsMsg'
Learn More
Learn More
cGAS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£294.00 - £435.00
Specifications
| Antigen | cGAS |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18252765
|
Novus Biologicals
NBP2-55374 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695398
|
Novus Biologicals
NBP2-55374-25ul |
25 μL |
£294.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
cGAS Polyclonal specifically detects cGAS in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| cGAS | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 115004 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYER | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| C6orf150, c-GAS, cyclic GMP-AMP synthase, h-cGAS, Mab-21 domain containing 1 | |
| MB21D1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title