missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CETP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CETP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CETP Polyclonal specifically detects CETP in Human samples. It is validated for Western Blot.Specifications
| CETP | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P11597 | |
| 1071 | |
| Synthetic peptides corresponding to CETP(cholesteryl ester transfer protein, plasma) The peptide sequence was selected from the middle region of CETP. Peptide sequence KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| cholesteryl ester transfer protein, cholesteryl ester transfer protein, plasma, HDLCQ10, Lipid transfer protein I | |
| CETP | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title