CEP85L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-90780

Product Code. 18299336

Beschreibung

CEP85L Polyclonal specifically detects CEP85L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: C6orf204/CEP85L
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: bA57K17.2, C6orf204, centrosomal protein 85kDa-like, CEP85L, chromosome 6 open reading frame 204, NY-BR-15, RP11-57K17.2, serologically defined breast cancer antigen NY-BR-15
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 387119
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CEP85L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SKLRESLTPDGSKWSTSLMQTLGNHSRGEQDSSLDMKDFRPLRKWSSLSKLTAPDNCGQGGTVCREESRNGLEK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only