missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15944605

Invitrogen™ CEP68 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15944605
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15944605 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15944605 Supplier Invitrogen™ Supplier No. PA579031

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human COLO-320 whole cell, human SK-OV-3 whole cell, human Jurkat whole cell, rat heart tissue, mouse heart tissue.

Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CEP68
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CEP68
Gene Accession No. Q76N32, Q8C0D9
Gene Alias 6030463E10Rik; AI481761; BC027174; centrosomal protein 68; centrosomal protein 68kDa; centrosomal protein of 68 kDa; Cep68; Kiaa0582; RGD1309101
Gene Symbols CEP68
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 216543, 23177, 289822
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.