missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CEP57 Antibody, Novus Biologicals™

CEP57 Antibody, Novus Biologicals™

Product Code. 18419340 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18419340 25 μL 25µL
18235218 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18419340 Supplier Novus Biologicals Supplier No. NBP18304525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

CEP57 Polyclonal specifically detects CEP57 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CEP57
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias centrosomal protein 57kDa, Cep57, FGF2-interacting protein, KIAA0092centrosomal protein of 57 kDa, PIG8, Testis-specific protein 57, Translokin, TSP57proliferation-inducing protein 8
Gene Symbols CEP57
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9702
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.