CEP55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-53039

Product Code. 18262405

Description

CEP55 Polyclonal specifically detects CEP55 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CEP55
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C10orf3, cancer/testis antigen 111, centrosomal protein 55kDa, centrosomal protein of 55 kDa, Cep55, chromosome 10 open reading frame 3, CT111, FLJ10540, Up-regulated in colon cancer 6, URCC6
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55165
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53EZ4
• Gene Symbols: CEP55
• Immunogen: Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the middle region of CEP55. Peptide sequence TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

For Research Use Only