missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEP55 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CEP55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CEP55 Polyclonal specifically detects CEP55 in Human samples. It is validated for Western Blot.Specifications
| CEP55 | |
| Polyclonal | |
| Rabbit | |
| Q53EZ4 | |
| 55165 | |
| Synthetic peptides corresponding to CEP55(centrosomal protein 55kDa) The peptide sequence was selected from the N terminal of CEP55. Peptide sequence MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C10orf3, cancer/testis antigen 111, centrosomal protein 55kDa, centrosomal protein of 55 kDa, Cep55, chromosome 10 open reading frame 3, CT111, FLJ10540, Up-regulated in colon cancer 6, URCC6 | |
| CEP55 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title