missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEP290 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | CEP290 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231835
|
Novus Biologicals
NBP3-35649-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227653
|
Novus Biologicals
NBP3-35649-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEP290 Polyclonal antibody specifically detects CEP290 in Human samples. It is validated for ELISA,Western BlotSpecifications
| CEP290 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Vision | |
| PBS (pH 7.3), 50% glycerol | |
| 80184 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BBS14Bardet-Biedl syndrome 14 protein, Cancer/testis antigen 87, centrosomal protein 290kDa, Cep290, CT87JBTS6, FLJ13615, JBTS5CTCL tumor antigen se2-2, KIAA0373FLJ21979, LCA10monoclonal 3H11 antigen, MKS4, Nephrocystin-6, NPHP6centrosomal protein of 290 kDa, POC3, POC3 centriolar protein homolog, prostate cancer antigen T21, rd16,3H11AG, SLSN6nephrocytsin-6,3H11Ag, Tumor antigen se2-2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 950-1050 of human CEP290 (NP_079390.3).,, Sequence:, QKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title