missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CENPQ Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£390.00
Specifications
| Antigen | CENPQ |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CENPQ Polyclonal specifically detects CENPQ in Human samples. It is validated for Western Blot.Specifications
| CENPQ | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C6orf139, CENP-QFLJ10545, centromere protein Q, chromosome 6 open reading frame 139 | |
| CENPQ | |
| IgG | |
| 30 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q7L2Z9 | |
| 55166 | |
| Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title