missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CENPP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58596-25ul
This item is not returnable.
View return policy
Description
CENPP Polyclonal specifically detects CENPP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| CENPP | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CENP-PRP11-19J3.3, centromere protein P, FLJ33928 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| CENPP | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELD | |
| 25 μL | |
| Cell Cycle and Replication | |
| 401541 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu