CENPM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58577-25ul

Product Code. 18681499

Description

CENPM Polyclonal specifically detects CENPM in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CENPM
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: bK250D10.2, C22orf18PANE1MGC861, CENP-Mchromosome 22 open reading frame 18, centromere protein M, ICEN39, Interphase centromere complex protein 39, Pane1, proliferation associated nuclear element 1, Proliferation-associated nuclear element protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CENPM
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TEESLRHVDASFFLGKVCFLATGAGRESHCSIHRHTVVKLAHTYQSPLLYCDLEVEG
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 79019
• Target Species: Human
• Isotype: IgG

For Research Use Only