CENPB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35700-100ul

Produktkod. 30231510

Beskrivning

CENPB Polyclonal antibody specifically detects CENPB in Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifikationer

• Antigen: CENPB
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: CENP-B, centromere autoantigen B, Centromere protein B, centromere protein B (80kD), centromere protein B, 80kDa, major centromere autoantigen B
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human CENPB (NP_001801.1).,, Sequence:, TLHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQAGVRGLGHQS
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Chromatin Research, DNA Repair
• Gene ID (Entrez): 1059
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Mouse, Rat
• Form: Purified