missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEND1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | CEND1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CEND1 Polyclonal specifically detects CEND1 in Human samples. It is validated for Western Blot.Specifications
| CEND1 | |
| Polyclonal | |
| Rabbit | |
| BM88 antigen, cell cycle exit and neuronal differentiation 1, cell cycle exit and neuronal differentiation protein 1, FLJ90066 | |
| CEND1 | |
| IgG | |
| 15 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 51286 | |
| Synthetic peptides corresponding to CEND1(cell cycle exit and neuronal differentiation 1) The peptide sequence was selected from the N terminal of CEND1. Peptide sequence MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title