missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEBP Delta Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | CEBP Delta |
|---|---|
| Dilution | Western Blot 1:10000 - 1:200000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231862
|
Novus Biologicals
NBP3-33314-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30226534
|
Novus Biologicals
NBP3-33314-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEBP Delta Monoclonal antibody specifically detects CEBP Delta in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| CEBP Delta | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Endocrinology, Immunology, Innate Immunity, metabolism | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 1052 | |
| IgG | |
| Affinity purified |
| Western Blot 1:10000 - 1:200000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| C/EBP-delta, CCAAT/enhancer binding protein (C/EBP), delta, CCAAT/enhancer-binding protein delta, CELF, CRP3, NF-IL6-betaC/EBP delta, Nuclear factor NF-IL6-beta | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CEBP Delta (NP_005186.2).,, Sequence:, PAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title