missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEBP Delta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | CEBP Delta |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18202805
|
Novus Biologicals
NBP2-56564 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613488
|
Novus Biologicals
NBP2-56564-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEBP Delta Polyclonal specifically detects CEBP Delta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| CEBP Delta | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C/EBP-delta, CCAAT/enhancer binding protein (C/EBP), delta, CCAAT/enhancer-binding protein delta, CELF, CRP3, NF-IL6-betaC/EBP delta, Nuclear factor NF-IL6-beta | |
| CEBPD | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 1052 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title