missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEACAM5/CD66e Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£250.00 - £443.00
Specifications
| Antigen | CEACAM5/CD66e |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20-1:50 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18458450
|
Novus Biologicals
NBP1-85742-25ul |
25 μL |
£250.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18263697
|
Novus Biologicals
NBP1-85742 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CEACAM5/CD66e Polyclonal specifically detects CEACAM5/CD66e in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CEACAM5/CD66e | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Carcinoembryonic antigen, carcinoembryonic antigen-related cell adhesion molecule 5, CD66e antigen, CEACD66e, DKFZp781M2392, Meconium antigen 100 | |
| CEACAM5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20-1:50 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Cellular Markers, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1048 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title