CDY2B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17478-100UL

Product Code. 18379381

Description

CDY2B Polyclonal antibody specifically detects CDY2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: CDY2B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: CDY, chromodomain protein, Y chromosome, 2 related, chromodomain protein, Y-linked, 2B, testis-specific chromodomain protein Y 2, testis-specific chromodomain protein Y protein 2 related
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203611
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG