missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDY2B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17478-25UL
This item is not returnable.
View return policy
Description
CDY2B Polyclonal antibody specifically detects CDY2B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CDY2B | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| CDY, chromodomain protein, Y chromosome, 2 related, chromodomain protein, Y-linked, 2B, testis-specific chromodomain protein Y 2, testis-specific chromodomain protein Y protein 2 related | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RQTEKQKKLTWTTTSRIFSNNARRRTSRSTKANYSKNSP | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 203611 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction