missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
CDY2A Monoclonal antibody specifically detects CDY2A in Human samples. It is validated for ELISA,Western Blot,Sandwich ELISA
Specifications
Specifications
| Antigen | CDY2A |
| Applications | ELISA, Western Blot, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 4C8 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_004816 |
| Gene Alias | CDY, CDY2CDY2B, chromodomain protein, Y chromosome, 2, chromodomain protein, Y-linked, 2, chromodomain protein, Y-linked, 2A, EC 2.3.1.48, testis-specific chromodomain protein Y 2, testis-specific chromodomain protein Y protein 2, Y chromosome chromodomain protein 2A |
| Host Species | Mouse |
| Immunogen | CDY2A (NP_004816, 123 a.a. ∽ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ASTLSDTKNMEIINSTIETLAPDSPFDHKKTVSGFQKLEKLDPIAADQQDTVVFKVTEGKLLRDPLSHPGAEQTGIQNKTQMHPLMSQMSGS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?