CDX4 Antibody (1E9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00001046-M12

Product Code. 18315398

Description

CDX4 Monoclonal antibody specifically detects CDX4 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: CDX4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: caudal type homeo box transcription factor 4, caudal type homeobox 4, caudal type homeobox transcription factor 4, Caudal-type homeobox protein 4, homeobox protein CDX-4
• Immunogen: CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
• Quantity: 0.1 mg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, ELISA, Immunocytochemistry
• Clone: 1E9
• Dilution: Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
• Gene Accession No.: NP_005184
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1046
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ