missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDV3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35853-100ul
This item is not returnable.
View return policy
Description
CDV3 Polyclonal antibody specifically detects CDV3 in Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| CDV3 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| CDV3 homolog (mouse), H41carnitine deficiency-associated gene expressed in ventricle 3, protein CDV3 homolog | |
| A synthetic peptide corresponding to a sequence within amino acids 150-250 of human CDV3 (NP_060018.1).,, Sequence:, PPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQ | |
| 100 μL | |
| Primary | |
| Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 55573 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction