missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £443.00
Specifications
| Antigen | CDS2 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18491931
|
Novus Biologicals
NBP1-86435-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18279697
|
Novus Biologicals
NBP1-86435 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CDS2 Polyclonal specifically detects CDS2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CDS2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| CDP-DAG synthase 2, CDP-DG synthase 2, CDP-DG synthetase 2, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2, CDP-diacylglycerol synthase 2, CDP-diglyceride diphosphorylase 2, CDP-diglyceride pyrophosphorylase 2, CDP-diglyceride synthase 2, CDP-diglyceride synthetase 2, CDS 2, CTP:phosphatidate cytidylyltransferase 2, EC 2.7.7, EC 2.7.7.41, FLJ38111, phosphatidate cytidylyltransferase 2 | |
| CDS2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8760 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title